| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 699992 | Error | Structure prediction | nlallah | P00383Dhfr | 78 | 25 Jan 2026 | 11 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: MERSSNEVSNPVAGNFVFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 690354 | 1 | 1 | n/a | RoseTTAFold | 1-78 | 78 | 25 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington