pre_rosetta_reoriented.pdb
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 700304 | Complete | Structure prediction | max_root827 | pre_rosetta_reoriented.pd... | 60 | 29 Jan 2026 | 15 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: PHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIPKNHFGIGGEPASK
disopred: ----------------------------------------------------------DD
tmhmm: ------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 690674 | 1 | 1 | n/a | comparative modeling | 1-60 | 60 | 29 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington