ectodomain_STA_MSA_raptorx
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 700862 | Error | Structure prediction | myriamtrrs3 | ectodomain_STA_MSA_raptor... | 255 | 4 Feb 2026 | 21 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 .
sequence: NHKVTLTTAIIQDATNQIKNTTPTYLTQNPQLGISFSNLSGTTSQSTTILASTTPSAESTPQSTTVKIKNTTTTQILPSKPTTKQRQNKPQNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKPKEVLTTKPTGKPTINTTKTNIRTTLLTSNTKGNPEHTSQEETLHSTTSEGYPSPSQVYTTSGQEETLHSTTSEGYPSPSQVTTSEYLSQSLSSSNTTK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 691187 | 1 | 1 | n/a | RoseTTAFold | 1-255 | 255 | 4 Feb 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington