QAU-FA1
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 700887 | Error | Structure prediction | faisal1234 | QAU-FA1 | 102 | 4 Feb 2026 | 21 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: GQMVHQAISPRTLNAWVKVIEEKAFSPEVIPMFTALSEGTTPQGLNTMLNTVGGHQPTMQMLKATINESAAESGRLHPIHAGPIAPGQMREPRGSDIAGTTS
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 691208 | 1 | 1 | n/a | RoseTTAFold | 1-102 | 102 | 4 Feb 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington