P4-16-21
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 700939 | Error | Structure prediction | Joanna | P4-16-21 | 57 | 5 Feb 2026 | 22 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: YDKNYKIKPFDEGGGGGSNIDPQPDFKAFKENLEAQAGPGGGGSAITKTTILKGVSQ
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 691253 | 1 | 1 | n/a | RoseTTAFold | 1-57 | 57 | 5 Feb 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington