sample619_design0
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 701116 | Error | Structure prediction | novic035 | sample619_design0 | 43 | 7 Feb 2026 | 24 Mar 2026 |
1 . 10 . 20 . 30 . 40
sequence: DEEAKKLVRKLMHNGVYGMRLERALKRLGFSPEQVKKIVRDVE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 691372 | 1 | 1 | n/a | RoseTTAFold | 1-43 | 43 | 7 Feb 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington