| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 701428 | Expired | Structure prediction | Isabuella | 7DDH model 1 | 65 | 11 Feb 2026 | 29 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MAGLSTDDGGSPKGDVDPFYYDYETVRNGGLIFAALAFIVGLIIILSKRLRCGGKKHRPINEDEL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 691829 | 1 | 1 | n/a | RoseTTAFold | 1-65 | 65 | 11 Feb 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington