8R15
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 701923 | Complete | Structure prediction | DENVERjessie | 8R15 | 72 | 28 Feb 2026 | 15 Apr 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: TGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPRYYVTVIDAPGH
disopred: ---------------------DDDDD----------------------------------------------
tmhmm: ------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 692305 | 1 | 1 | n/a | comparative modeling | 1-72 | 72 | 1 Mar 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington