Otra_T
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 702204 | Complete | Structure prediction | Alex Rivera-Vargas | Otra_T | 49 | 10 Mar 2026 | 26 Apr 2026 |
1 . 10 . 20 . 30 . 40 .
sequence: VPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT
disopred: ---------------------DDDDDDDDDDDDDDDDD-------DDDD
tmhmm: ---TTTTTTTTTTTTTTTTTT----------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 692498 | 1 | 1 | 0.33 | comparative modeling | 1-49 | 49 | 12 Mar 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington