2026-03-14_00000351_full_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 702332 | Active | Structure prediction | RoseTTAFold | 2026-03-14_00000351_full_... | 172 | 14 Mar 2026 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170
sequence: MEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGGGSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARS
disopred: ------------------------------------------------------------DDDDDDDDDDDD------------------DDDDDDDDD-----------------------------------------------------------------------DD
tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 692535 | 1 | 1 | n/a | RoseTTAFold | 1-172 | 172 | 14 Mar 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington