test_1CGO
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 702600 | Active | Structure prediction | Ae Ji Park | test_1CGO | 127 | 26 Mar 2026 | 10 May 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 .
sequence: QFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
disopred: DDD----------------------------------------------------------------------------------------------DDDDD----------------------DDD
tmhmm: -------------------------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 692735 | 1 | 1 | n/a | ab initio | 1-127 | 127 | 26 Mar 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington