scratch.pdb
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 703059 | Complete | Structure prediction | clerif | scratch.pdb | 39 | 17 Apr 2026 | 1 Jun 2026 |
1 . 10 . 20 . 30 .
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
disopred: DD----------------------DDDDDDDDDDDDDDD
tmhmm: ---------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 693017 | 1 | 1 | n/a | comparative modeling | 1-39 | 39 | 17 Apr 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington