2026-05-02_00000274_full_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 703394 | Active | Structure prediction | RoseTTAFold | 2026-05-02_00000274_full_... | 52 | 2 May 2026 | - |
1 . 10 . 20 . 30 . 40 . 50
sequence: MNKYVCLVCGYEYDPEIGDLEGGIKPGTKFEDLPEDWLCPLCGVTKFDFEKI
disopred: ----------------------------------------------------
tmhmm: ----------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 693259 | 1 | 1 | n/a | RoseTTAFold | 1-52 | 52 | 2 May 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington