2021-05-22_00000237_2_19
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
77099 | Complete | Structure prediction | RoseTTAFold | 2021-05-22_00000237_2_19 | 145 | 22 May 2021 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 .
sequence: VTAKELAEKAGAAAGLKAGDIHGMKIVIEGLKALKVDTLKSGIFNSFVQNSHYTEVTGLAIAIDTEMNEVCSATYIGIHPICVVREKLGVIPKAGGTMVKQKDAITNVLKQALEKATQSAEALSETTAEDVAAKLTAQKTGAINT
disopred: ------------------------------------------------------------------------------------------------------------------------------------------------D
tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
75051 | 1 | 1 | 0.72 | RoseTTAFold | 1-145 | 145 | 22 May 2021 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington