2021-07-03_00000091_2_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 88849 | Complete | Structure prediction | RoseTTAFold | 2021-07-03_00000091_2_19 | 59 | 3 Jul 2021 | - |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: NEFDRIIENQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITTVPFRTTKERQENLYFQG
disopred: D----DDDDDDDDDDDDDDDDDD-------------------------DDDDDDDDDDD
tmhmm: -----------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 86270 | 1 | 1 | 0.73 | RoseTTAFold | 1-59 | 59 | 3 Jul 2021 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington