2021-07-17_00000138_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
96480CompleteStructure predictioncameo2021-07-17_00000138_1_1115417 Jul 2021-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    
   sequence: GPLGSPEPDTARLDADPSASGPVMEFRELQKGAYIEPTGAFLTRARNSVSSSIPYPARAACLLVAVSQATGLPTRTLWAALCANLPDSVLDDGSLATLGLTTDHFAVLARIFSLRCRFVSEHGDVELGLHDATSRFTIRHTPGHFELVADNFSL
   disopred: DDDDDDDDDDDDDDDDD------------------------------DDDDD-----------------------------------------------------------------------------------------------DDDD-DD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
91406110.83TrRefineRosetta1-15415417 Jul 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington