2021-07-17_00000176_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
96487CompleteStructure predictioncameo2021-07-17_00000176_1_113117 Jul 2021-
             1   .   10    .   20    .   30 
   sequence: MITISTMLQFGLFLIALIGLVIKLIELSNKK
   disopred: D--------------------------DDDD
      tmhmm: ----TTTTTTTTTTTTTTTTTTTTTTT----
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
91416110.92TrRefineRosetta1-313117 Jul 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington