T0960 Domain 1 Parse 1 Confidence: 0.02
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 171 | Complete | Structure prediction | casp | T0960 | 384 | 11 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 251 | 1 | 1 | 0.02 | comparative modeling | 1-67 | 67 | 11 May 2018 |
>251
SGSEFVTAGMALAATDIPGLDASKLVSGVLAEQRLPVFARGLATAVSNSSDPNTATVPLMLTNHANG
>2lh9A_w039 weight: 1.0000 score: 0.08975 eval: n/a prob: n/a identity: 0.1194 startpos: 3
---------MLEADLVSKMLRAVLQSHKNIVLPRLQGEYRSLTGDWIPFPTLEAYSGEI--------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington