2022-04-09_00000151_1_19 Domain 1 Parse 1 Confidence: 0.06
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 272893 | Complete | Structure prediction | RoseTTAFold | 2022-04-09_00000151_1_19 | 1172 | 9 Apr 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 268970 | 1 | 1 | 0.06 | comparative modeling | 1-99 | 99 | 10 Apr 2022 |
>268970
MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQ
>4rqoB_201 weight: 0.9953 score: 27.39 eval: 150 prob: 21.46 identity: 0.1414 startpos: 13
-------------------IGPSSSHTVGPMLAANAFLQlkNLFDKtkeLYGSLakAILNgsMIPRMHEIlnLAGKKEIPFHEATDFLFLQ--------
>4rqoA_203 weight: 0.0047 score: 27.46 eval: 140 prob: 22.45 identity: 0.1313 startpos: 11
------------------GIGPSSSHTVGPMLAANAFLQlkNLFDKtkeLYGSLAlaILnksMIPRMHEILdlAGKKEIPFHEATDFLFLqlLPKHS--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington