2024-07-27_00000166_1_19 Domain 3 Parse 1 Confidence: 0.07
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
626924 | Complete | Structure prediction | RoseTTAFold | 2024-07-27_00000166_1_19 | 1241 | 27 Jul 2024 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
622742 | 3 | 1 | 0.07 | comparative modeling | 223-290 | 68 | 16 Aug 2024 |
>622742
WSPSASYDLRERLCPGSALGNPGGPEQQVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSR
>6jnpA_201 weight: 1.0000 score: 17.34 eval: 640 prob: 19.1 identity: 0.1471 startpos: 2
--------------------LGEVEARQVATPR-EAQQLAQ---------RQEAPKGEGL--------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington