4JHU Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 639222 | Complete | Structure prediction | amorales | 4JHU | 47 | 31 Oct 2024 | 15 Dec 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 632842 | 1 | 1 | n/a | comparative modeling | 1-47 | 47 | 31 Oct 2024 |
>632842
HWHGFFQAGTSWADGPAFVTQCPIASGDSFLYDFRARDQAGTFWYHS
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.8085 startpos: 1
HWHGFFQHGTNWADGPAFVNQCPISPGHSFLYDFQVPDQAGTFWYHS
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington