FABPI_HUMAN Fatty acid-binding protein intestinal Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 692505 | Expired | Structure prediction | giovannapalermo | FABPI_HUMAN Fatty acid-bi... | 132 | 3 Nov 2025 | 18 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 683538 | 1 | 1 | n/a | comparative modeling | 1-132 | 132 | 3 Nov 2025 |
>683538
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.9848 startpos: 1
-AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington