Dermacentor 229-309 in 2POH Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 693950 | Complete | Structure prediction | ksh130 | Dermacentor 229-309 in 2P... | 81 | 14 Nov 2025 | 29 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 684899 | 1 | 1 | n/a | comparative modeling | 1-81 | 81 | 14 Nov 2025 |
>684899
STPEKVEILAPPPGAQPGDRVVCDGYPGQPDAQLNPKKKIFEQVAPDLKTDSEKRATYKGKPWLVTGRQGHVTAETLCNVQ
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.2099 startpos: 1
AQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVD-DHESRITANTKAITVTTAEGEITAENQADYV
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington