IAPP Domain 1 Parse 1 Confidence: 0.37
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 700165 | Complete | Structure prediction | a-ziaj | IAPP | 89 | 27 Jan 2026 | 13 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 690542 | 1 | 1 | 0.37 | comparative modeling | 1-89 | 89 | 27 Jan 2026 |
>690542
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
>6ucjA_301 weight: 0.3914 score: 3.9 eval: n/a prob: n/a identity: 0.7528 startpos: 1
----------------------TPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
>6ucjA_201 weight: 0.3528 score: 209.49 eval: 2.8e-38 prob: 100 identity: 0.7528 startpos: 1
----------------------TPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
>6ucjA_102 weight: 0.2558 score: 3.9 eval: n/a prob: n/a identity: 0.7528 startpos: 1
----------------------TPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington