scratch.pdb Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 703059 | Complete | Structure prediction | clerif | scratch.pdb | 39 | 17 Apr 2026 | 1 Jun 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 693017 | 1 | 1 | n/a | comparative modeling | 1-39 | 39 | 17 Apr 2026 |
>693017
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 1.0000 startpos: 1
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington