T1021s3 Domain 2 Parse 1 Confidence: 0.45
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
486 | Complete | Structure prediction | casp | T1021s3 | 295 | 13 Jul 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
700 | 2 | 1 | 0.45 | comparative modeling | 221-295 | 75 | 13 Jul 2018 |
>700
AMTHVNLDSSPVANSDGSAAEIRVSLRVYGMTPTEYLAPMNTVFNEWEKSEAAAVTPDGYRVYINAVDKTDLTGI
>4hjgE_301 weight: 0.8283 score: 6.78 eval: n/a prob: n/a identity: 0.0800 startpos: 1
---EVTIKVNLIFADGKI-QTAEFKGT-----FEEATAEAYRYAALLAKVNgyTADLegNHMNIKFAG-------
>1hz6A_302 weight: 0.0377 score: 6.58 eval: n/a prob: n/a identity: 0.0933 startpos: 3
AMEEVTIKANLIFANGST-QTAEFKGTF-----EKATSEAYAYADTLKKDNgwTVDVAdyTLNIKFAG-------
>1xf5L_303 weight: 0.0362 score: 6.51 eval: n/a prob: n/a identity: 0.0933 startpos: 6
PKEEVTIKVNLIFADGKI-QTAEFKGT-----FEEATAEAYRYADLLAKVNgwTADLegNCMNIKFAGK------
>4hkzE_305 weight: 0.0333 score: 6.35 eval: n/a prob: n/a identity: 0.0800 startpos: 1
--SEVTIKVNLIFADGK---IQTAEFKGT---FEEATAEAYRYAALLAKVNgyTADLegNHMNIKFAG-------
>1hz5A_304 weight: 0.0331 score: 6.44 eval: n/a prob: n/a identity: 0.0933 startpos: 8
AMEEVTIKANLIFANGS---TQTAEFKGT---FEKATSEAYAYADTLKKDNgwTVDVAdyTLNIKFAG-------
>1mhhE_307 weight: 0.0313 score: 6.25 eval: n/a prob: n/a identity: 0.0800 startpos: 1
---EVTIKVNLIFADGKI-QTAEFKGT-----FEEATAEAYRYAALLAKVNgwTADLEdnHMNIKFAGK------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington