T1061 Domain 2 Parse 1 Confidence: 0.07
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 29815 | Complete | Structure prediction | casp | T1061 | 949 | 19 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 29308 | 2 | 1 | 0.07 | comparative modeling | 184-243 | 60 | 20 Jun 2020 |
>29308
VNGTLQPSNGAKRPEYQEDYGFFHSNKSTTILAKYQVKEERYKLQSKKKLFGLSRSYSLK
>2bcwC_301 weight: 1.0000 score: 8.92 eval: n/a prob: n/a identity: 0.1000 startpos: 2
IPEEYLDQAREYHEKLVEVAA----DFDENIMLKYLEGEEPTEEELVAAIRkiDLKITP-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington