T1061 Domain 7 Parse 1 Confidence: 0.11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 29815 | Complete | Structure prediction | casp | T1061 | 949 | 19 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 29313 | 7 | 1 | 0.11 | comparative modeling | 667-756 | 90 | 20 Jun 2020 |
>29313
KFIGIEPNDPIAFTYERYGWKDKFFLVDEVENTRDGKINLVLQEYGEDVFINSEQVDNSGNDIPDISNNVLPPRDFKYTPTPGGVVGAIG
>2zb6A_201 weight: 1.0000 score: 27.38 eval: 250 prob: 16.13 identity: 0.2111 startpos: 240
---TVELKIKIASGFGpykhNNVylTIPPMKNLALGVINTliKEAGGDCHAPTYLPAEVDGDVKLSSNLvlPGQDLQYVLATYD------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington