T1094 Domain 4 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
33153 | Complete | Structure prediction | casp | T1094 | 496 | 23 Jul 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
32176 | 4 | 1 | 0.00 | comparative modeling | 430-496 | 67 | 23 Jul 2020 |
>32176
TNNKLRGLHPSYLGRLGLTSTSAGDPGASGSLTPFLELPENSYMHFTEEPEINLNIDDISIDEVIES
>m0vxA_101 weight: 1.0000 score: 21.2 eval: 0.0049 prob: n/a identity: 0.0597 startpos: 3
------------VVELEFVCRD-----EDSFFVETSRR--dCRVELDSlqLYYVRLEGASPADVFER
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington