2022-08-20_00000176_1_19 Domain 3 Parse 1 Confidence: 0.38
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
398445 | Complete | Structure prediction | RoseTTAFold | 2022-08-20_00000176_1_19 | 1469 | 20 Aug 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
393733 | 3 | 1 | 0.38 | comparative modeling | 1339-1461 | 123 | 21 Aug 2022 |
>393733
NWTVPELTLDIFNATYLNLTGEIDDLEFRSEKLHNTTVELAILIDNINNTLVNLEWLNRIETYVKSGGYIPEAPRDGQAYVRKDGEWVLLSTFLVPRGSGGSGGSGLNDIFEAQKIEWHEGGS
>7kywA_301 weight: 1.0000 score: 5.35 eval: n/a prob: n/a identity: 0.0813 startpos: 1
--------GSWQTYVDEHLMCEIE----------GHHLASAAILGHDGtpQFKPEEITGIMKDFDEPGHLApgEPGRVIRGKKGAGGITIKkvVGIYDEPMTPGQCNMVVERLGDYLVEQGM-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington