2023-03-25_00000113_1_11 Domain 1 Parse 1 Confidence: 0.32
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
500205 | Complete | Structure prediction | cameo | 2023-03-25_00000113_1_11 | 1876 | 25 Mar 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
495810 | 1 | 1 | 0.32 | comparative modeling | 1-112 | 112 | 28 Mar 2023 |
>495810
MNTDQQPYQGQTDYTQGPGNGQSQEQDYDQYGQPLYPSQADGYYDPNVAAGTEADMYGQQPPNESYDQDYTNGEYYGQPPNMAAQDGENFSDFSSYGPPGTPGYDSYGGQYT
>7vd5Q_201 weight: 1.0000 score: 20.14 eval: n/a prob: 11.87 identity: 0.0982 startpos: 11
----------------------------------------------------------------GDGTSYSEGAAYG-----TDQADKLYSPYSVYSPEGEklYKPDN----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington