2023-04-22_00000043_1_11 Domain 3 Parse 1 Confidence: 0.16
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 509661 | Complete | Structure prediction | cameo | 2023-04-22_00000043_1_11 | 1507 | 22 Apr 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 504672 | 3 | 1 | 0.16 | comparative modeling | 426-481 | 56 | 22 Apr 2023 |
>504672
VVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQS
>1f60A_101 weight: 1.0000 score: 9.891 eval: 0.014 prob: n/a identity: 0.0714 startpos: 274
------------------VVTFAPAGVTTEVKSVE---------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington