2023-05-13_00000202_1_19 Domain 5 Parse 1 Confidence: 0.69
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
517265 | Complete | Structure prediction | RoseTTAFold | 2023-05-13_00000202_1_19 | 2068 | 13 May 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
514332 | 5 | 1 | 0.69 | comparative modeling | 598-668 | 71 | 19 May 2023 |
>514332
PCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAE
>7rd1A_w071 weight: 1.0000 score: 0.90187 eval: n/a prob: n/a identity: 0.0282 startpos: 7
---PVTLAVSFK-PSSQEHTFGVE-NI------TGLALKMKPCGGQ-AARYLPGSYSAANLKTKVYSG---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington