IAPP Domain 1 Parse 1 Confidence: 0.37
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 700165 | Complete | Structure prediction | a-ziaj | IAPP | 89 | 27 Jan 2026 | 13 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 690542 | 1 | 1 | 0.37 | comparative modeling | 1-89 | 89 | 27 Jan 2026 |
>690542
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
>2kj7A_101 weight: 0.4814 score: 2.16 eval: n/a prob: n/a identity: 0.3483 startpos: 1
---------------------------------KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-------------------
>2kj7A_302 weight: 0.3740 score: 2.16 eval: n/a prob: n/a identity: 0.3483 startpos: 1
---------------------------------KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-------------------
>2kj7A_202 weight: 0.1446 score: 107.75 eval: 2.6e-19 prob: 99.77 identity: 0.3483 startpos: 1
---------------------------------KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington