I20V_CM Domain 1 Parse 1 Confidence: 0.37
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 701005 | Complete | Structure prediction | haramos | I20V_CM | 62 | 6 Feb 2026 | 23 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 691333 | 1 | 1 | 0.37 | comparative modeling | 1-62 | 62 | 6 Feb 2026 |
>691333
MPRRQWRWTRMTLTRAHYKVDGQLCLHWRPNSENLRGNLQIWWQLKNWLQNQLIQQGLSLMI
>m0jiA_201 weight: 1.0000 score: 18.41 eval: 410 prob: 31.23 identity: 0.1935 startpos: 25
EVLEDCPYtpRMEVRV-Y-HDARmaeyVYPNMHQPDEKSQLNLFLGEWLSHCLSC-GHE---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington