2021-05-22_00000305_1_19 Domain 1 Parse 1 Confidence: 0.46
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 77105 | Complete | Structure prediction | RoseTTAFold | 2021-05-22_00000305_1_19 | 1391 | 22 May 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 75182 | 1 | 1 | 0.46 | comparative modeling | 1-37 | 37 | 22 May 2021 |
>75182
MKRGFARPTPEKPPVIKPENIVLSTPLSIPPPEGKPW
>1izlK_302 weight: 1.0000 score: 10.92 eval: n/a prob: n/a identity: 0.1351 startpos: 1
-AYAIFDPLVDVLPVIPVLFLALAFVWQ---------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington