T1061 Domain 7 Parse 1 Confidence: 0.11
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
29815 | Complete | Structure prediction | casp | T1061 | 949 | 19 Jun 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
29313 | 7 | 1 | 0.11 | comparative modeling | 667-756 | 90 | 20 Jun 2020 |
>29313
KFIGIEPNDPIAFTYERYGWKDKFFLVDEVENTRDGKINLVLQEYGEDVFINSEQVDNSGNDIPDISNNVLPPRDFKYTPTPGGVVGAIG
>5m1iA_102 weight: 0.9227 score: 29.69 eval: 0.015 prob: n/a identity: 0.0778 startpos: 35
---------TVEFAVEKI--HLGWKISGRVKGS-PGRLEVLRTKAPEKVLVNN-------------------------------------
>6gwfA_103 weight: 0.0407 score: 29.61 eval: 0.015 prob: n/a identity: 0.0778 startpos: 31
---------TVEFAVEKI--HLGWKISGRVKGS-PGRLEVLRTKAPEKVLVNN-------------------------------------
>6gtaA_104 weight: 0.0366 score: 29.56 eval: 0.015 prob: n/a identity: 0.0778 startpos: 28
---------TVEFAVEKI--HLGWKISGRVKGS-PGRLEVLRTKAPEKVLVNN-------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington