T1074 Domain 2 Parse 1 Confidence: 0.28
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 31420 | Complete | Structure prediction | casp | T1074 | 202 | 2 Jul 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 30680 | 2 | 1 | 0.28 | comparative modeling | 124-202 | 79 | 3 Jul 2020 |
>30680
MYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF
>2y4xA_101 weight: 1.0000 score: 21.31 eval: 0.024 prob: n/a identity: 0.1013 startpos: 31
------------------TFALVKGA-rVRVGDYLGR-----NDGKVVGISEGKIDVIEIVPD----------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington