test30_1 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 699622 | Domain complete | Structure prediction | wevangelista | test30_1 | 35 | 20 Jan 2026 | 8 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 690127 | 1 | 1 | 0.00 | comparative modeling | 1-35 | 35 | 22 Jan 2026 |
>690127
DCWVHSCIITTDTSQRSKLSNTGHPYEMHREPPQF
>8to09_301 weight: 0.6386 score: 10.24 eval: n/a prob: n/a identity: 0.1143 startpos: 1
-----KESIYTTSYPRLPVCAMSRREHAIPVPHPR
>8to09_104 weight: 0.3614 score: 10.24 eval: n/a prob: n/a identity: 0.1143 startpos: 1
-----KESIYTTSYPRLPVCAMSRREHAIPVPHPR
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington