T1021s3 Domain 2 Parse 1 Confidence: 0.45
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 486 | Complete | Structure prediction | casp | T1021s3 | 295 | 13 Jul 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 700 | 2 | 1 | 0.45 | comparative modeling | 221-295 | 75 | 13 Jul 2018 |
>700
AMTHVNLDSSPVANSDGSAAEIRVSLRVYGMTPTEYLAPMNTVFNEWEKSEAAAVTPDGYRVYINAVDKTDLTGI
>1mitA_w000 weight: 1.0000 score: 0.00216 eval: n/a prob: n/a identity: 0.0933 startpos: 10
-----WPHLVGVGGSVAKAIIE-RQNPNVKAVILEEGTPV---TK-DFRCNRVRIWVNGLVVSPPRI--------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington