T1064 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
30186 | Complete | Structure prediction | casp | T1064 | 106 | 22 Jun 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
29585 | 1 | 1 | 0.00 | comparative modeling | 1-106 | 106 | 22 Jun 2020 |
>29585
FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
>3x29B_302 weight: 1.0000 score: 5.04 eval: n/a prob: n/a identity: 0.1038 startpos: 3
ATERLNLTDALNSNpwRSSNSYPWTQKLNLHLTITAT-------------GQKYRILASKIVDFNIYSNnvDISLD---AGQYVLVMKANSSYSGNYPYAILFQKF
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington