2022-08-20_00000174_1_19 Domain 3 Parse 1 Confidence: 0.38
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 398443 | Complete | Structure prediction | RoseTTAFold | 2022-08-20_00000174_1_19 | 1295 | 20 Aug 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 394080 | 3 | 1 | 0.38 | comparative modeling | 1196-1287 | 92 | 22 Aug 2022 |
>394080
KLHNTTVELAILIDNINNTLVNLEWLNRIETYVKSGGYIPEAPRDGQAYVRKDGEWVLLSTFLVPRGSGGSGGSGLNDIFEAQKIEWHEGGS
>1ylxA_303 weight: 1.0000 score: 6.15 eval: n/a prob: n/a identity: 0.1413 startpos: 1
------------MEFAPRSVVIEEFIDTLEPMMEAYGlvGIFEEHGeyTINKDDEMITIHMPFVKNERGekGFHSLQEAMEEVIHS------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington