T1017s2 Domain 1 Parse 1 Confidence: 0.17
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 478 | Complete | Structure prediction | casp | T1017s2 | 129 | 11 Jul 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 683 | 1 | 1 | 0.17 | comparative modeling | 1-129 | 129 | 11 Jul 2018 |
>683
HQEVQQQRFDELSKIYDKSHPVGELTVDGQTIRQSSVSNRYGMTKVFESQNLTDKQIHNYAQQLAGDTPLKEVRPGIYTAKLENGTSITLRSLSSSQEQTGARWTIDIKGNKQLSDIAYKYKDVEIKFK
>4wbyA_110 weight: 1.0000 score: 42.34 eval: 0.0069 prob: n/a identity: 0.0620 startpos: 5
VPENIEEIAREVGQIAKEM--GLRAYIVGGVVRDILLGKEVWDVDFVVEG--NAIELAKELARRHGVNVHPFPEFGTAHLKIG-KLKLEFATAR-----------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington