2021-08-07_00000081_1_19 Domain 2 Parse 1 Confidence: 0.05
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
107890 | Complete | Structure prediction | RoseTTAFold | 2021-08-07_00000081_1_19 | 1909 | 7 Aug 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
105031 | 2 | 1 | 0.05 | comparative modeling | 164-248 | 85 | 10 Aug 2021 |
>105031
DEAGNNKKKRECNNYRRDGRDREVRGYWERDKVGSNELVYRSGTWEADHERDVKKVSGGNRECDVKAEENKSKPEERKEKVVEEQ
>3aiiA_101 weight: 1.0000 score: 16.1 eval: 0.033 prob: n/a identity: 0.0353 startpos: 437
-------------------------GFARLDsgPGMVFYYAHK------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington