2021-08-07_00000081_1_19 Domain 2 Parse 1 Confidence: 0.05

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
107890CompleteStructure predictionRoseTTAFold2021-08-07_00000081_1_1919097 Aug 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
105031210.05comparative modeling164-2488510 Aug 2021
              .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .   
   sequence: DEAGNNKKKRECNNYRRDGRDREVRGYWERDKVGSNELVYRSGTWEADHERDVKKVSGGNRECDVKAEENKSKPEERKEKVVEEQ
 deepconcnf: ---------------------------EEE------EEEEE--------------------------------------------
    psipred: -------------------------------------EEEEE-------------------------------HHHH--------
    spider3: ---------------------------EEE-------EEEE--------------------H---HHHH----------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington