T1063 Domain 1 Parse 1 Confidence: 0.62
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
30187 | Complete | Structure prediction | casp | T1063 | 196 | 22 Jun 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
29616 | 1 | 1 | 0.62 | comparative modeling | 1-83 | 83 | 22 Jun 2020 |
>29616
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPE
>2bsgA_w001 weight: 1.0000 score: 0.01482 eval: n/a prob: n/a identity: 0.0602 startpos: 57
-------EILNGRASVSGNNAVQNLQIGAGIKGQVVALNTLVNGNGSTVEERNSIKANETSVTQEVNTNISSDVQA-------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington