T1063 Domain 1 Parse 1 Confidence: 0.62

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
30187CompleteStructure predictioncaspT106319622 Jun 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
29616110.62comparative modeling1-838322 Jun 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80   
   sequence: MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPE
 deepconcnf: -------EE---HHHH-H-----EE------E--HHH--------------------------------HHHHHHHHH-----
    psipred: -----------HHHHHHHH----EE-----HHHHHHHHHHH--------------------EE------HHHHHHHHH-----
    spider3: ----HHH------HHHHH-----EE------E-HHHHHHHH------------E------HHH------HHHHHHHHHH----
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington