2023-11-11_00000094_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
564802 | Complete | Structure prediction | RoseTTAFold | 2023-11-11_00000094_1_19 | 58 | 11 Nov 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
559777 | 1 | 1 | 0.86 | RoseTTAFold | 1-58 | 58 | 11 Nov 2023 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: GSMIRCPKDKIYKFCGSPCPPSCKDLTPNCTRECKKGCFCRDGTVDNNHGKCVKKENC
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington