2023-11-11_00000094_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 564802 | Complete | Structure prediction | RoseTTAFold | 2023-11-11_00000094_1_19 | 58 | 11 Nov 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: GSMIRCPKDKIYKFCGSPCPPSCKDLTPNCTRECKKGCFCRDGTVDNNHGKCVKKENC
disopred: DDD-------------------------------------------------------
tmhmm: ----------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 559777 | 1 | 1 | 0.86 | RoseTTAFold | 1-58 | 58 | 11 Nov 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington