Robetta8p6q Domain 1 Parse 1 Confidence: 0.90

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
699989CompleteStructure prediction ValentineRobetta8p6q4525 Jan 202612 Mar 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
690363110.90comparative modeling1-454526 Jan 2026
             1   .   10    .   20    .   30    .   40    .
   sequence: SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington